Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIN2(RIN2)

Code CSB-CF855391DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8VYC8
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MGIKYLPVSVASTALSFVGLQVWTELSLDRLRADGLIAKNISLGDSEHALELLLGSYFTI ALLTNFVLNVYILLVLSLKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQG VLWTVWLTVLCTLKMFQALARDRLERLNASPSSTPWTYFRVYSVLFLVLSVDMFWIKLSL MTYNTIGSAVYLLLLFEPCSIAFETLQALLIHGFQLLDMWINHLAVKNSDCQRSKFIDSM TAGSLLEWKGLLNRNLGFFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLSA ILKRIKGYIKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHLFHLGC LRSWLDQGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALAT GLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLAS VGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNIL AMAETVREVMPHVPDEIIFQDLQRTNSVAVTVNNLLQM
Source in vitro E.coli expression system
Gene Names RIN2
Protein Names Recommended name: E3 ubiquitin protein ligase RIN2 EC= 6.3.2.- Alternative name(s): AMF receptor-like protein 1A RPM1-interacting protein 2
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 ubiquitin protein ligase that acts as positive regulator of RPM1- and RPS2-dependent hypersensitive response (HR), in association with RIN3. Probably not required for RPM1 degradation during HR.
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: ath:AT4G25230

STRING: 3702.AT4G25230.1

UniGene: At.43259

Related Products

RIN2 Antibodies

RIN2 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RIN2 Proteins

RIN2 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.