Recombinant Arabidopsis thaliana GDT1-like protein 1, chloroplastic(At1g64150)

Code CSB-CF822006DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q94AX5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence CFQRNDAACYLEKAESEEHDRNLDVLVESSIAHSRREIQRVLMFLAVSGSVALLGTDPAF AASSIPNVTQSLVTSFGDLGDISSGFASAFLLIFFSELGDKTFFIAALLAARNSAATVFV GTFGALGIMTIISVVLGRTFHYVDEVLPFRFGGTDLPIDDIAAVCLLVYFGVSTLLDAVS DEGKADEEQKEAELAVSELSGNGAGIVAAANTIISTFALVFVAEWGDKSFFSTIALAAAS SPLGVIAGALAGHGAATLLAVLGGSLLGNFLSEKAIAYVGGVLFLVFAAVTVAEIVT
Source in vitro E.coli expression system
Gene Names PAM71
Protein Names Recommended name: GDT1-like protein 1, chloroplastic
Expression Region 74-370
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mn(2+)/H(+) exchanger, which transport Mn(2+)from the chloroplast stroma into the acidic thylakoid lumen
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein, Thylakoid
Protein Families GDT1 family
Database Links

KEGG: ath:AT1G64150

STRING: 3702.AT1G64150.1

UniGene: At.26167

Related Products

PAM71 Antibodies

PAM71 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PAM71 Proteins

PAM71 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.