Recombinant Arabidopsis thaliana GDT1-like protein 2, chloroplastic(At4g13590)

Code CSB-CF890497DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9T0H9
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence ASDAGVGSGSYSGGEEDGSQSSSLDQSPATSSESLKPRGPFPYSLSIALVLLSCGLVFSL ITFVKGGPSSVLAAVAKSGFTAAFSLIFVSEIGDKTFFIAALLAMQYEKTLVLLGSMGAL SLMTILSVVIGKIFQSVPAQFQTTLPIGEYAAIALLMFFGLKSIKDAWDLPPVEAKNGEE TGIELGEYSEAEELVKEKASKKLTNPLEILWKSFSLVFFAEWGDRSMLATVALGAAQSPL GVASGAIAGHLVATVLAIMGGAFLANYISEKLVGYVGGALFLVFAAATFFGVF
Source in vitro E.coli expression system
Gene Names PAM71-HL
Protein Names Recommended name: GDT1-like protein 2, chloroplastic
Expression Region 67-359
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable chloroplast-localized Mn(2+)/H(+) and/or Ca(2+)/H(+) antiporter regulating Ca(2+), Mn(2+) and pH homeostasis.
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families GDT1 family
Database Links

KEGG: ath:AT4G13590

STRING: 3702.AT4G13590.1

UniGene: At.33360

Related Products

PAM71-HL Antibodies

PAM71-HL Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PAM71-HL Proteins

PAM71-HL Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.