Recombinant Arabidopsis thaliana Inner membrane protein ALBINO3, chloroplastic (ALB3)

Code CSB-CF818524DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ALB3
Uniprot No.
Alternative Names
ALB3; At2g28800; F8N16.9; Inner membrane protein ALBINO3, chloroplastic
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
57-462
Target Protein Sequence
SLNEIPPFHGLDSSVDIGAIFTRAESLLYTIADAAVVGADSVVTTDSSAVQKSGGWFGFI SDAMELVLKILKDGLSAVHVPYAYGFAIILLTIIVKAATYPLTKQQVESTLAMQNLQPKI KAIQQRYAGNQERIQLETSRLYKQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLFT EGFFWIPSLGGPTSIAARQSGSGISWLFPFVDGHPPLGWYDTVAYLVLPVLLIASQYVSM EIMKPPQTDDPAQKNTLLVFKFLPLMIGYFALSVPSGLSIYWLTNNVLSTAQQVYLRKLG GAKPNMDENASKIISAGRAKRSIAQPDDAGERFRQLKEQEKRSKKNKAVAKDTVELVEES QSESEEGSDDEEEEAREGALASSTTSKPLPEVGQRRSKRSKRKRTV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the insertion of some light harvesting chlorophyll-binding proteins (LHCP) into the chloroplast thylakoid membrane. Required for the insertion of LHCB1, LHCB4.1 and LHCB5 proteins into thylakoid membrane, while it is not required for insertion of proteins PsbX, PsbW and PsbY.
Gene References into Functions
  1. ALB3 contributes to the process of protein insertion into the thylakoids via the ALB3-chloroplast signal recognition particle pathway. PMID: 26265777
  2. Data indicate that the conserved positively charged residue was not required for the E. coli YidC or the A. thaliana Alb3 to functionally complement the E. coli YidC depletion strain or to promote insertion of YidC-dependent membrane proteins. PMID: 25359772
  3. TerC, together with ALB3, facilitates de novo synthesis of thylakoid membrane proteins. PMID: 24612058
  4. cpSRP43 inserts into a dimeric Alb3 translocation pore during cpSRP-dependent delivery of light-harvesting chlorophyll a,b-binding proteins PMID: 21832051
  5. Propose that cpSRP43 is crucial for the binding of LHCP-loaded cpSRP and cpFtsY to Alb3. In addition, data suggest that a direct interaction between Alb3 and LHCP contributes to the formation of this complex. PMID: 20828566
  6. The activation of TFL1 expression by PPF1 defines an important pathway possibly essential for the negative regulation of plant senescence in transgenic Arabidopsis. [PPF1] PMID: 18713382
  7. Alb3 is adapted for the chloroplast-specific Alb3-cpSRP43 interaction in post-translational targeting by extending the spectrum of chromodomain interactions. PMID: 20018841
  8. Alb3 has a role in insertion of a subset of the light-harvesting chlorophyll-binding proteins, while Alb4 is required for proper chloroplast biogenesis PMID: 16595657
  9. alb3 mutants generally exhibit defects in the biogenesis of light-harvesting chlorophyll proteins and other thylakoidal membrane proteins that are more severe than in the cpftsY mutants. PMID: 18764927

Show More

Hide All

Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Protein Families
OXA1/ALB3/YidC (TC 2.A.9.2) family
Tissue Specificity
Mainly expressed in organs that contain green tissues such as leaves, flower buds and stems.
Database Links

KEGG: ath:AT2G28800

STRING: 3702.AT2G28800.1

UniGene: At.10324

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×