Recombinant Arabidopsis thaliana PRA1 family protein B4(PRA1B4)

Code CSB-CF529294DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O80915
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MASSAPPVLPISNPQTVPSAAPSSVESQPPIATPAFRNFINQITETVKNGLSKRRPWAEL ADRSALSKPESISDAAVRIRKNYSYFKVNYLTVATAIVGFSLVTHPFSLVFLLCLLASWL FLYLFRPTDQPIVLFGRTFSDRETLGCLILFSIFVIFLTDVGSVLVSAMMIGVALICAHG AFRAPEDLFLDEQEPAATGFLSFLGGAASSAAPAVIAARV
Source in vitro E.coli expression system
Gene Names PRA1B4
Protein Names Recommended name: PRA1 family protein B4 Short name= AtPRA1.B4
Expression Region 1-220
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.
Subcellular Location Endosome membrane, Multi-pass membrane protein
Protein Families PRA1 family
Tissue Specificity Expressed in roots, lateral roots, lateral root caps, stomata and trichomes.
Database Links

KEGG: ath:AT2G38360

STRING: 3702.AT2G38360.1

UniGene: At.24545

Related Products

PRA1B4 Antibodies

PRA1B4 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PRA1B4 Proteins

PRA1B4 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.