Recombinant Arabidopsis thaliana PRA1 family protein B5(PRA1B5)

Code CSB-CF878652DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9M012
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MVSTNPPVLPISTTATDTTNQPPIVTAVVESQPPVVRAFVNGVTETVCGGLSRSRPWSEL LDRSAFTKPDSLSEAGTRFRKNSSYFRVNYVCIVALILGFSLLAHPFSLILLLCLAASWL FLYLFRPSDRPLILFGRSFSEYETLGGLILSTIAVIFFTSVGSVLISALMIGIATICVHG AFRAPDDLFLDEQDHAASGFLSFIGVPAIPSVAPSASSAASPV
Source in vitro E.coli expression system
Gene Names PRA1B5
Protein Names Recommended name: PRA1 family protein B5 Short name= AtPRA1.B5
Expression Region 1-223
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.
Subcellular Location Endosome membrane, Multi-pass membrane protein
Protein Families PRA1 family
Tissue Specificity Expressed in roots, lateral roots, lateral root caps, columella cells, leaves, and shoot apex.
Database Links

KEGG: ath:AT5G01640

STRING: 3702.AT5G01640.1

UniGene: At.33527

Related Products

PRA1B5 Antibodies

PRA1B5 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PRA1B5 Proteins

PRA1B5 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.