Recombinant Arabidopsis thaliana Phosphate transporter PHO1 homolog 1(PHO1-H1)

Code CSB-CF835966DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q93ZF5
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MVKFTKQFEGQLVPEWKDAFVDYSQLKKDLKKIHLFTNGVEKKHTETSLIKTVKSSLGRL SIFGNKGREQSRVIQVHKKLASSGSNNDVYETELLEKIADDTDAAKEFFACLDMQLNKVN QFYKTKEKEFLERGECLKKQMDILIELKDAFKQKQANGESTQESKEDDSISCTISCEYDS VRGRTEEMQLQVSCLDNLEDNGEEALESLGSEEPIKANNEDSKLTTVSSRVFSCQGKNVK IKIPLTNPSRTFSAISYLINQSSSKKNGPDGGNKLQISKKKLSHAEKMIKGALTELFKGL NYLKTYRNLNILAFMNILKKFDKVTGKQILPIYLKVVESSYFNISDKVMILSDEVEEWFI KHLAGENRRKAMKYLKPHHRKESHSVTFFIGLFTGCFVALLAGYIIVAHLTGMYRQHSAN TFYMETAYPVLSMFGLLFLHLFLYGCNIFMWRKARINYSFIFELGSKNELKYRDVFLICT ASMSAIAGVMFVHLSLLEKGYSFRQVQVIPGLLLLGFLLILICPLNIFYKSSRYRLISVI RNIVFSPLYKVVMLDFFMADQLCSQVPMLRNLEYIACYYITGSYATQDYEYCMRVKYYRD LAYAVSFLPYYWRAMQCARRWFDEGETSHLVNLGKYVSAMLAAGTKVAYEKERSLGWLCL VVAMSSVATIYQLYWDFVKDWGLLQHNSNNPWLRNQLMLRQKSIYYFSMVLNLVLRLAWL QTVLHSSFEHVDYRVTGLFLAALEVIRRGQWNFYRLENEHLNNAGKFRAVKTVPLPFREV DEED
Source in vitro E.coli expression system
Gene Names PHO1-H1
Protein Names Recommended name: Phosphate transporter PHO1 homolog 1 Alternative name(s): Protein PHO1 homolog 1 Short name= AtPHO1;H1
Expression Region 1-784
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Contributes to the loading of inorganic phosphate (Pi) into the root xylem vessels.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families SYG1 (TC 2.A.94) family
Tissue Specificity Expressed in vascular cylinder of roots, leaves, stems, petals, sepals and filaments. Expressed in receptacle, stigma apex and anther connective tissue.
Database Links

KEGG: ath:AT1G68740

STRING: 3702.AT1G68740.1

UniGene: At.26310

Related Products

PHO1-H1 Antibodies

PHO1-H1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PHO1-H1 Proteins

PHO1-H1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.