Recombinant Arabidopsis thaliana Phosphate transporter PHO1 homolog 4(PHO1-H4)

Code CSB-CF754331DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6R8G6
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MRFGKEFVSQMIPEWQEAYIDYAYLKTILQDIQASRNRSDSNNQSSTPSFARNLTRRYNR DALVSENHDIVVNTVTRLEEGLETAAYETTFLKAGEAGGDFEVTFFRTLDREFNKVNNFY RLKVETARTEALALNKQMDALIAFRHKVMDQNQKNPSVFDSVSEDINGSASEVGSSSKCT EHNVALADLMRNEDTSNESILERIRMNKTREITPLSAIKTILKVHKQDELKFTRDNLKEV EKRLQVAFIEFYQKLRHLKNYSFLNASAVSKIMKKYDKIAKRNAAKLYMEMVDKSFLSSS EEVHKLLLKVESIFIEHFSNSNRREGMSHLRPKINKERHLITFSTGFFFGCGISLIVALG LIIHARNIMGTPGQRTYMETMFPLYRFFGFVVLHMDVYAANIYFWRRYRVNYSFIFGFKQ GTELGYRHVLLLSFGLGTLSLCAVLLNLDMEMDAQTKDYRLVTELIPLFLLVLVIIIVLC PFNILYRSSRFFFLSVLFRCIAAPFYAVHLPDFFLGDQLTSQVQALRSLEFYICYYGFGD FRYRRRNTCTSNIGFRTFYFIVAVIPYWLRFLQCIRRMVEDRDLSHGYNGIKYLLTIVAA SLRTAYTLNRGSNWNITAWVFSGVATFYGTYWDIVLDWGLLQRGCKNSFLRDKLLVPHKT VYYAAMVLNVLLRLVWLQTVLDLKFSFLHRETMVALMACLEIIRRGIWNFFRLENEHLNN VGRYRAFKTVPLPFNYEEDGDHHNN
Source in vitro E.coli expression system
Gene Names PHO1-H4
Protein Names Recommended name: Phosphate transporter PHO1 homolog 4 Alternative name(s): Protein PHO1 homolog 4 Short name= AtPHO1;H4
Expression Region 1-745
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May transport inorganic phosphate (Pi).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families SYG1 (TC 2.A.94) family
Tissue Specificity Expressed in root epidermis and cortex, leaf hydathodes, pollen grains and stigma apex.
Database Links

KEGG: ath:AT4G25350

STRING: 3702.AT4G25350.1

UniGene: At.49408

Related Products

PHO1-H4 Antibodies

PHO1-H4 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PHO1-H4 Proteins

PHO1-H4 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.