Recombinant Arabidopsis thaliana Phosphate transporter PHO1 homolog 7(PHO1-H7)

Code CSB-CF750941DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6R8G3
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MKFGKDFVRQMIPEWQQAYMDYAGLKSILQEIQTSRKRSERPGILKRKLSGSRNFSGLTK RYSRTASTREPEIQDILVHATTGDDGFERYETTILEVAEAGRESELAFFKTLDLEFDKVN HFYRSKVEEMVKEAVVLNKQMDALIAFRIKVERPSSSWSCSETVSVDMNALDSNDQRNTL AEEMGIRVEGNGSNGGDSTKESVPQVLSVLERIRLNKTQETPLSTIKNVLKLSNQEELKF TRENLKKIEERLKNVFIEFYRKLRHLKNYSFLNTLAISKIMKKYDKIASRSAAKPYMEMV DKSYLTSSDEINKLMLRVESTFVEHFAGLNRSKGMNLLRPKVKKEKHRITFSTGFFVGCT VSLVVALVMFIHARNIMGAVGHKVYMETMFPLYSLFAFVVLHMIMYASNIYFWKRYRVNY PFIFGFKEGTELGYRHVLLLSFGLGTLALCAVLINLDMEMDPNTNDYKTMTELLPMFILA LVVAILFCPFNIFYRSSRVFFLMVVFRCIAAPLYKVNLPDFFLADQLTSQVQALRSLEFY ICYYGWGDFKHRQNTCRSSDVYSTFYFIVAVIPYWSRFLQCVRRLIEENDSSQGYNALKY LLTVVAVCLRTAYSFNRGNIWKISAWVFSALATFYGTYWDIVFDWGLLHRPSKHLLREKL LVPHKAVYYVAIVLNIVLRMAWLQTVLDFNLSFLHRETMIALLAALEIIRRGIWNFFRLE NEHLNNVGKFRAFKSVPLPFNYNEEEDRDS
Source in vitro E.coli expression system
Gene Names PHO1-H7
Protein Names Recommended name: Phosphate transporter PHO1 homolog 7 Alternative name(s): Protein PHO1 homolog 7 Short name= AtPHO1;H7
Expression Region 1-750
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May transport inorganic phosphate (Pi).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families SYG1 (TC 2.A.94) family
Tissue Specificity Expressed in root tips, vascular cylinders of roots and filaments, leaf hydathodes, stem, receptacle and stigma apex.
Database Links

KEGG: ath:AT1G26730

STRING: 3702.AT1G26730.1

UniGene: At.49308

Related Products

PHO1-H7 Antibodies

PHO1-H7 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PHO1-H7 Proteins

PHO1-H7 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.