Recombinant Arabidopsis thaliana Photosystem II 22 kDa protein, chloroplastic (PSBS)

Code CSB-CF894502DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PSBS
Uniprot No.
Alternative Names
PSBS; NPQ4; At1g44575; T18F15.3; Photosystem II 22 kDa protein, chloroplastic; CP22; Protein NONPHOTOCHEMICAL QUENCHING 4; Protein PHOTOSYSTEM II SUBUNIT S
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
60-265
Target Protein Sequence
AAPKKVEKPKSKVEDGIFGTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGILAQL NLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDPPTGLEKAVIPPGKNVRSALG LKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPIQDIEPLVL LNVAFFFFAAINPGNGKFITDDGEES
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in non-photochemical quenching, a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage. Is not necessary for efficient light harvesting and photosynthesis.
Gene References into Functions
  1. The interaction of PsbS with the antenna system is affected by both DeltapH and the level of zeaxanthin. PMID: 28134919
  2. the importance of LHCII aggregation in the NPQ mechanism PMID: 26233261
  3. Npq1 and npq4 mutants are equally protected against photodamage, but less protected than WT plants. PMID: 25429003
  4. It was concluded that functional PsbS is required for optimization of absorbed photon fate and optimal light acclimatory responses. PMID: 25654166
  5. Leaves from three different Arabidopsis lines with different expression levels of PsbS protein showed different levels of non-photochemical quenching. The PsbS deficient plant npq4 showed remarkable reduction of electron transport rate. PMID: 25047739
  6. the presence of violaxanthin deepoxidase, but not the protein PsbS, changes the excited-state relaxation dynamics of chlorophyll; the presence of both zeaxanthin and PsbS is required for strong quenching PMID: 25422428
  7. Changes in the complement of light-harvesting complexes and PsbS have striking effects on the photosystem II macrostructure, and these effects correlate with changes in the mobility of chlorophyll proteins within the thylakoid membrane. PMID: 21919982
  8. Direct interaction of the major light-harvesting complex II and PsbS in nonphotochemical quenching. PMID: 23509270
  9. Restoration of rapidly reversible photoprotective energy dissipation in the absence of PsbS protein by enhanced DeltapH. PMID: 21474447
  10. Data suggest that PsbS plays the role of a kinetic modulator of the energy dissipation process in the PSII light-harvesting antenna. PMID: 19843315
  11. Data suggest that PsbS controls the macro-organisation of the grana membrane, providing an explanation of its role in NPQ. PMID: 20035752
  12. The effects of two different mutations of PsbS on the metabolism of photosystem II in A. thaliana are reported. PMID: 16075321
  13. Binding of two molecules of zeaxanthin in the three-dimensional model of PsbS is postulated. The molecular mechanism of photoprotection by PsbS is explained through the model. PMID: 16538483
  14. PsbS acts as a trigger of the conformational change that leads to the establishment of nonphotochemical quenching. PMID: 16545380
  15. Transgenic Arabidopsis lines synthesizing only the altered psbS forms exhibited severely impaired NPQ capacity PMID: 17306227
  16. xanthophyll dependence of energy dissipation is not due to PsbS but to other pigment-binding proteins, probably of the Lhcb type PMID: 18070876
  17. The level of PsbS is a determinant of plant fitness, metabolism and gene expression. Lack of PsbS results in increased photooxidative stress in the chloroplasts. PMID: 19171025

Show More

Hide All

Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Protein Families
ELIP/psbS family
Database Links

KEGG: ath:AT1G44575

STRING: 3702.AT1G44575.1

UniGene: At.21534

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1