Recombinant Arabidopsis thaliana Phytol kinase 1, chloroplastic(VTE5)

Code CSB-CF881870DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9LZ76
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence SAVATNSLLHDVGATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWP IFSGSTEARYFAAFVPLVNGLRLVINGLSISPNSMLIKSVTREGRAEELLKGPLFYVLAL LFSAVFFWRESPIGMISLAMMCGGDGIADIMGRKFGSTKIPYNPRKSWAGSISMFIFGFF ISIALLYYYSSLGYLHMNWETTLQRVAMVSMVATVVESLPITDQLDDNISVPLATILAAY LSFGY
Source in vitro E.coli expression system
Gene Names VTE5
Protein Names Recommended name: Phytol kinase 1, chloroplastic EC= 2.7.-.- Alternative name(s): Vitamin E pathway gene 5 protein
Expression Region 60-304
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Kinase involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytol monophosphate (PMP) in the presence of CTP or UTP. No activity with ATP or GTP as phosphoryl donor.
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families Polyprenol kinase family
Database Links

KEGG: ath:AT5G04490

STRING: 3702.AT5G04490.1

UniGene: At.33117

Related Products

VTE5 Antibodies

VTE5 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

VTE5 Proteins

VTE5 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.