Recombinant Arabidopsis thaliana Probable aquaporin PIP2-6(PIP2-6)

Code CSB-CF104237DOA
Product Type Transmembrane Protein
Size $647
Uniprot No. Q9ZV07
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MTKDELTEEESLSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLYVTVLTVIGFKSQTDINAGGGACASVGLLGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYGSVRSQLHELHA
Source in vitro E.coli expression system
Gene Names PIP2-6
Expression Region 1-289
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Tissue Specificity Expressed above ground, and in flower buds.
Database Links

KEGG: ath:AT2G39010

STRING: 3702.AT2G39010.1

UniGene: At.13247

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.