Recombinant Arabidopsis thaliana Probable aquaporin PIP2-6(PIP2-6)

Code CSB-CF104237DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ZV07
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MTKDELTEEESLSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLYVTVLTVIGFKSQTDINAGGGACASVGLLGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYGSVRSQLHELHA
Source in vitro E.coli expression system
Gene Names PIP2-6
Expression Region 1-289
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Tissue Specificity Expressed above ground, and in flower buds.
Database Links

KEGG: ath:AT2G39010

STRING: 3702.AT2G39010.1

UniGene: At.13247

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.