Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 6(B3GALT6)

Code CSB-CF878720DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9MAP8
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MGMGRYQKSATSGVSARWVFVLCISSFLLGVLVVNRLLASFETVDGIERASPEQNDQSRS LNPLVDCESKEGDILSRVSHTHDVIKTLDKTISSLEVELATARAARSDGRDGSPAVAKTV ADQSKIRPRMFFVMGIMTAFSSRKRRDSIRGTWLPKGDELKRLETEKGIIMRFVIGHSSS PGGVLDHTIEAEEEQHKDFFRLNHIEGYHELSSKTQIYFSSAVAKWDADFYIKVDDDVHV NLGMLGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIY AISKDLATYISVNRQLLHKYANEDVSLGSWFIGLDVEHIDDRSLCCGTPLDCEWKGQAGN PCAASFDWSCSGICKSVDRMLEVHQRCGEGDGAIWHSSF
Source in vitro E.coli expression system
Gene Names GALT31A
Protein Names Recommended name: Probable beta-1,3-galactosyltransferase 6 EC= 2.4.1.-
Expression Region 1-399
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Beta-galactosyltransferase involved in elongation of beta-1,6-linked galactan side chains on arabinogalactan proteins. Required for the progression of embryogenesis beyond the globular stage
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 31 family
Database Links

KEGG: ath:AT1G32930

STRING: 3702.AT1G32930.1

UniGene: At.40035

Related Products

GALT31A Antibodies

GALT31A Antibodies for Arabidopsis thaliana (Mouse-ear cress)

GALT31A Proteins

GALT31A Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.