Recombinant Arabidopsis thaliana Protein TRIGALACTOSYLDIACYLGLYCEROL 2, chloroplastic(TGD2)

Code CSB-CF873352DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9LTR2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence AASNSDAAHGQPSSDGGKNPLTVVLDVPRNIWRQTLKPLSDFGFGKRSIWEGGVGLFIVS GATLLALSWAWLRGFQMRSKFRKYQTVFELSHASGICTGTPVRIRGVTVGTIIRVNPSLK NIEAVAEIEDDKIIIPRNSLVEVNQSGLLMETMIDIMPRNPIPEPSVGPLHPECGKEGLI VCDRQTIKGVQGVSLDELVGIFTRIGREVEAIGVANTYSLAERAASVIEEARPLLKKIQA MAEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDLRKVNSSIMTPENTELIQKSIYTLVY TLKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL
Source in vitro E.coli expression system
Gene Names TGD2
Protein Names Recommended name: Protein TRIGALACTOSYLDIACYLGLYCEROL 2, chloroplastic Alternative name(s): ABC transporter I family member 15 Short name= ABC transporter ABCI.15 Short name= AtABCI15
Expression Region 46-381
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of a phosphatidic acid/lipid transport complex in the chloroplast envelope. Specifically binds phosphatidic acid (PA). Involved in lipid transfer from the endoplasmic reticulum (ER) to plastids, and necessary for thylakoids formation.
Subcellular Location Plastid, chloroplast inner membrane, Single-pass membrane protein
Database Links

KEGG: ath:AT3G20320

STRING: 3702.AT3G20320.1

UniGene: At.8172

Related Products

TGD2 Antibodies

TGD2 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

TGD2 Proteins

TGD2 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.