Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 4(ALIS4)

Code CSB-CF874363DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9SA35
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MSTKKHNLLANFASSDSRFTQQELPACKPILTPKWVILTFLVSGVVFIPLGVICLFASQG VIEIVDRYDTDCIPLSSRDNKVRYIQGLEDKRCNRTITVTKTMKNPVYVYYQLENYYQNH RRYVKSRQDGQLRSPKDEHETKSCAPEDTLGGQPIVPCGLVAWSLFNDTYDFTRNNQKLP VNKKDISWKSDRESKFGKNVFPKNFQKGSLIGGKSLDQDIPLSEQEDLIVWMRTAALPTF RKLYGKIDTDLQAGDTIKVLLQNNYNTYSFNGKKKLVLSTTSWLGGRNDFLGIAYLTVGS ICLFLAVSFSVLYLAKPRQLGDPSYLSWNRSAGGGR
Source in vitro E.coli expression system
Gene Names ALIS4
Protein Names Recommended name: Putative ALA-interacting subunit 4 Short name= AtALIS4
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families CDC50/LEM3 family
Tissue Specificity Expressed in flowers. May be restricted to pollen grains.
Database Links

KEGG: ath:AT1G16360

STRING: 3702.AT1G16360.1

UniGene: At.41886

Related Products

ALIS4 Antibodies

ALIS4 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

ALIS4 Proteins

ALIS4 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.