Recombinant Arabidopsis thaliana Putative aluminum-activated malate transporter 3(ALMT3)

Code CSB-CF881772DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9LPQ8
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MAAPKLESFRRGSMFDGSFRRGSMFDGSFRQSMRDRLILQSRGYSNVNDDDKTSVRCCSY SYFSDKITGVVKKLKDVLVTAWEMGTADPRKMIFSAKMGLALTLTSILIFFKIPGLELSG HYLWAILTVVVIFEFSIGATFSKGCNRGLGTLSAGGLALGMSWISEMTGNWADVFNAASI FVVAFFATYAKLYPTMKPYEYGFRVFLLTYCYVIVSGYKTGEFMETAVSRFLLIALGASV GLIVNTCIYPIWAGEDLHNLVAKNFVNVATSLEGCVNGYLECVAYDTIPSRILVYEAVAE DPVYSGYRSAVQSTSQEDTLMSFASWEPPHGPYKSFRYPWALYVKVGGALRHCAIMVMAL HGCILSEIQAAEDRRREFRNELQRVGIEGAKVLRYIGESLKKMEKLNPIEDILYEIHQAA EELQSKIDKKSYLLVNAKNWEIGNRPRVRDLTDEQKISNLDSDLSRILAHKSQSEATLRP PKNWDDVTTAANLSSATMLPYLQSRTMIHKQPSWPSRISITPGSMLQPPLGEPGKMYESA SNLSLATFASLLIEFVARLENLVNAYDELSVKANFKEAVSE
Source in vitro E.coli expression system
Gene Names ALMT3
Protein Names Recommended name: Putative aluminum-activated malate transporter 3 Short name= AtALMT3
Expression Region 1-581
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Malate transporter.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Aromatic acid exporter (TC 2.A.85) family
Database Links

KEGG: ath:AT1G18420

STRING: 3702.AT1G18420.1

UniGene: At.41794

Related Products

ALMT3 Antibodies

ALMT3 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

ALMT3 Proteins

ALMT3 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.