Recombinant Arabidopsis thaliana Reticulon-like protein B21(RTNLB21)

Code CSB-CF684970DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q56X72
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MTPRRSLSSSDSNDKSPSVSVVAKKARSESVEGIEKKTTPGRVKKIRSEVCTTIVKAGEF DSVALRKVNSLPSPNSEKSDTKTEQEVTIIENSKIPEEVKEFGVCQEMIVSAKSNENEQI DNGDQEIGDQDDYEEDGDEEEEREVEKKSVDVKEINVAKENRVGGVEIKKFSQFQNRTSP SPSSVRKISPPVIKRATSVYSAPPNSTSSTDRFAEQEDNFTHSQSKLQSLVDLVMWRDVS RSTLVFGFGTFLIISSSYANDLNFSFISVVAYMGLIYLGLMFVLKSLIHRGMVEEERHKV VGVREEDVKRMLRLIMPYLNESLHQLRALFSGDPSTTLKMGVVLFVLARCGSSITLWNLA KFGFLGAFTIPKIFISYSTHFSAYGNFWMRRFRDAWESCNHKKAVALALFTLVWNLSSVT ARVWAAFMLLVAFRYYQHKMIWTTDQADDDEDDNEEEEAEEEKEQVPPKHKRAPPHMMMP NKLKKIS
Source in vitro E.coli expression system
Gene Names RTNLB21
Protein Names Recommended name: Reticulon-like protein B21 Short name= AtRTNLB21
Expression Region 1-487
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Database Links

KEGG: ath:AT5G58000

STRING: 3702.AT5G58000.1

UniGene: At.29301

Related Products

RTNLB21 Antibodies

RTNLB21 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RTNLB21 Proteins

RTNLB21 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.