Recombinant Arabidopsis thaliana Reticulon-like protein B4(RTNLB4)

Code CSB-CF884223DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9FFS0
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MVEDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVH KVLGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWS NACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGL WVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVL RKVISKIPRGALNKKKD
Source in vitro E.coli expression system
Gene Names RTNLB4
Protein Names Recommended name: Reticulon-like protein B4 Short name= AtRTNLB4 Alternative name(s): VirB2-interacting protein 3
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in the Agrobacterium-mediated plant transformation via its interaction with VirB2, the major component of the T-pilus.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Database Links

KEGG: ath:AT5G41600

STRING: 3702.AT5G41600.1

UniGene: At.8344

Related Products

RTNLB4 Antibodies

RTNLB4 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RTNLB4 Proteins

RTNLB4 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.