Recombinant Arabidopsis thaliana Reticulon-like protein B6(RTNLB6)

Code CSB-CF721841DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6DBN4
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MAEELEKSMHKEESLMEKIADKIHDHDSSSSSDSEHEKPESPSALKAKIYRLFGREKPVH KVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLS NAHAFMNKTPPKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGL WIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVL SKLPVASLKAKLG
Source in vitro E.coli expression system
Gene Names RTNLB6
Protein Names Recommended name: Reticulon-like protein B6 Short name= AtRTNLB6
Expression Region 1-253
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Database Links

KEGG: ath:AT3G61560

STRING: 3702.AT3G61560.2

UniGene: At.34268

Related Products

RTNLB6 Antibodies

RTNLB6 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RTNLB6 Proteins

RTNLB6 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.