Recombinant Arabidopsis thaliana Sphingoid base hydroxylase 2(SBH2)

Code CSB-CF858333DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9AST3
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MMSFVISDEFLGTFVPILVYWVYSGMYICLGSLDKYRLHSKIDEDEKNLVSKSAVVKGVL LQQTLQAIISVILFKITGSDADAATTQQFSILLLARQFIIAMLVIDTWQYFIHRYMHLNK FLYKHIHSQHHRLIVPYSYGALYNHPLEGLLLDTIGGALSFLFSGMSPRTAIFFFSFATI KTVDDHCGLWLPGNPFHIFFSNNSAYHDVHHQLYGTKYNFSQPFFVMWDRILGTYLPYSL EKRANGGFETRPIKVSKDE
Source in vitro E.coli expression system
Gene Names SBH2
Protein Names Recommended name: Sphingoid base hydroxylase 2 EC= 1.14.-.- Alternative name(s): Sphingoid C4-hydroxylase 2
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in sphingolipid trihydroxy long-chain base (4-hydroxysphinganine) biosynthesis. Can use C18- and C20-sphinganine as substrates to produce C18- and C20-phytosphinganines (D-ribo-2-amino-1,3,4-trihydroxyoctadecane and -eicosane).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Sterol desaturase family
Tissue Specificity Ubiquitous, with higher levels in flowers and roots.
Database Links

KEGG: ath:AT1G14290

STRING: 3702.AT1G14290.1

UniGene: At.28722

Related Products

SBH2 Antibodies

SBH2 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

SBH2 Proteins

SBH2 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.