Recombinant Arabidopsis thaliana Thylakoid ADP,ATP carrier protein, chloroplastic(TAAC)

Code CSB-CF881879DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9M024
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence RDRRESTFNGRNGGGGGAFASVSVVIPKEEDEFAPTSAQLLKNPIALLSIVPKDAALFFA GAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYWKGN LPQVIRIVPYSAVQLFAYETYKKLFRGKDGQLSVLGRLGAGACAGMTSTLITYPLDVLRL RLAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAPYIAINFCVFDLVKKSLPEKY QQKTQSSLLTAVVAAAIATGTCYPLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYR GFVPNALKSMPNSSIKLTTFDIVKKLIAASEKEIQRIADDNRKKASPNTIDEQT
Source in vitro E.coli expression system
Gene Names TAAC
Protein Names Recommended name: Thylakoid ADP,ATP carrier protein, chloroplastic Alternative name(s): Thylakoid ADP/ATP translocase
Expression Region 62-415
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Specifically transports adenine nucleotides. Involved in the uptake of ATP into thylakoids in exchange for lumenal ADP.
Subcellular Location Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein, Plastid, chloroplast envelope
Protein Families Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity Highly expressed in developing photosynthetic organs such as leaves, flower buds and green siliques. Also detected in roots, flowers, mature leaves and stems.
Database Links

KEGG: ath:AT5G01500

STRING: 3702.AT5G01500.1

UniGene: At.43427

Related Products

TAAC Antibodies

TAAC Antibodies for Arabidopsis thaliana (Mouse-ear cress)

TAAC Proteins

TAAC Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.