Recombinant Arabidopsis thaliana Translocator protein homolog (TSPO)

Code CSB-CF526860DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TSPO; At2g47770; F17A22.16; Translocator protein homolog; AtTSPO
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-196
Target Protein Sequence
MDSQDIRYRGGDDRDAATTAMAETERKSADDNKGKRDQKRAMAKRGLKSLTVAVAAPVLV TLFATYFLGTSDGYGNRAKSSSWIPPLWLLHTTCLASSGLMGLAAWLVWVDGGFHKKPNA LYLYLAQFLLCLVWDPVTFRVGSGVAGLAVWLGQSAALFGCYKAFNEISPVAGNLVKPCL AWAAFVAAVNVKLAVA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stress-induced membrane protein that can bind heme and may play a role in the transport of tetrapyrrole intermediates during salt stress and contribute to the detoxification of highly reactive porphyrins in the cytoplasm.
Gene References into Functions
  1. TSPO physically interacts with PIP2;7 at the endoplasmic reticulum and Golgi membranes. PMID: 25538184
  2. The arabidopsis TSPO (translocator protein)-related protein is transiently induced by abiotic stresses and ABA treatment. PMID: 21852759
  3. AtTSPO can localize to endoplasmic reticulum and mitochondria, but when plants are salt stressed AtTSPO is found in chloroplasts. PMID: 21689410
  4. At-TSPO is a heme binding membrane protein; its downregulation by plant cells requires heme binding. PMID: 21317376
  5. AtTSPO is targeted to the endoplasmic reticulum in plant cells and accumulates in the Trans-Golgi Network. PMID: 20847098
  6. AtTSPO is expressed in dry seeds and can be induced in vegetative tissues by osmotic and salt stress or abscisic acid (ABA) treatment. [AtTSPO] PMID: 19838071
  7. TSPO-related protein is expression localized to the endoplasmic reticulum and Golgi apparatus, and its expression is regulated by stress and abscisic acid. PMID: 19548979

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Plastid, chloroplast membrane; Multi-pass membrane protein. Note=Localizes in chloroplast upon salt stress.
Protein Families
TspO/BZRP family
Tissue Specificity
Specifically expressed in seeds (at protein level).
Database Links

KEGG: ath:AT2G47770

STRING: 3702.AT2G47770.1

UniGene: At.23206

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1