Recombinant Arabidopsis thaliana Uncharacterized protein At3g17611(At3g17611)

Code CSB-CF844586DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8RXW0
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MENFGEGRRSGGGMLPLLALSAVAEYYRLPWKPPVTASLLAANTLVYLRPAFIDPVIPHI SEVWFNPHLIFKHKDLKRLFLSAFYHVNEPHLVYNMMSLLWKGIKLETSMGSSEFASMVF TLIGMSQGVTLLLAKSLLLLFDYDRAYYNEYAVGFSGVLFAMKVVLNSQAEDYSSVYGIL VPTKYAAWAELILVQMFVPNASFLGHLGGILAGIIYLKLKGSYSGSDPVTMAVRGVSRLV TWPLRFLNGMVRSRRRRITGRGRVGRGQTGIAGPGIWRCQSCTYDNSGWLSACEMCGSGR ARGNGWSLNQGPALSSSNDLPLDELRRRRVERFS
Source in vitro E.coli expression system
Gene Names RBL14
Protein Names Recommended name: Uncharacterized protein At3g17611
Expression Region 1-334
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis. May function in the heat-shock response pathway.
Subcellular Location Mitochondrion membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Database Links

KEGG: ath:AT3G17611

STRING: 3702.AT3G17611.1

UniGene: At.6283

Related Products

RBL14 Antibodies

RBL14 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RBL14 Proteins

RBL14 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.