Recombinant Arabidopsis thaliana Uncharacterized protein At5g19025 (At5g19025)

Code CSB-CF317041DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0C8Q9
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MLHLFLFSSAASTTTAVEDNSTTMPPSSRSAANQNSSSSLHLCKHSPSATLDLLILILVL FSGTFLLSSYFSYLIHSLSLLSSHFPSITISLSSLLPPLIIFFSSDHSTEDEDHHHPSGK IPPPASFFFAFAVFFAASIAFLDLCCGSRSRKCRNPKCKGMKKAMEFDLQLQTEECVKSG SVKEIDRLPWKGGSESNPDYECLRAELRKMAPVNGRAVLIFRSKCGCPIAKLEGWGPKRS RRHKKSPAKLAVKGCIDNR
Source in vitro E.coli expression system
Gene Names At5g19025
Protein Names Recommended name: Uncharacterized protein At5g19025
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: ath:AT5G19025

STRING: 3702.AT5G19025.1

Related Products

At5g19025 Antibodies

At5g19025 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

At5g19025 Proteins

At5g19025 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.