Recombinant Ashbya gossypii Cytochrome c oxidase subunit 3(COX3)

Code CSB-CF741685DOT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q75G34
Storage Buffer Tris-based buffer,50% glycerol
Species Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Sequence MLYLNRSKFQQFPFHLVTPSPWPIVTSFSLLGLTLTLAFTMHGIIGNIYPLLLSLLVVLL TMTLWFRDIVAETTYLGDHTLAVRKGINLGFTLFVVSEVLIFASLFWAYFHSAMSPDITL GNVWPPVGIEAVQPTELPLLNTIILLASGTTITYSHHGLIEGNRKHALSGLTITFWLIVT FVLCQYIEYSNTSFTITDGIYGSVFFAGTGLHFLHMVMLTIMLGINYWRMRNYHLTSTHH VGYETTTIYLHVLDIIWLALYICFYWWGV
Source in vitro E.coli expression system
Gene Names COX3
Protein Names Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III
Expression Region 1-269
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Subunits I, II and III form the functional core of the enzyme complex.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Cytochrome c oxidase subunit 3 family
Database Links

KEGG: ago:AGOS_AMI003W

STRING: 33169.AAS50170

Related Products

COX3 Antibodies

COX3 Antibodies for Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

COX3 Proteins

COX3 Proteins for Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.