Recombinant Bacillus subtilis CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

Code CSB-CF017878BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P46322
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MFNLPNKITLARIALIPIFMIIMLAPFDWGRLEVGDESIPVAHLAGAILFIIASTTDWVD GYYARKLNLVTNFGKFLDPLADKLLVSAALIILVQFDLAPAWMVIVIISREFAVTGLRLV LAGTGEVVAANMLGKIKTWAQIIAVSALLLHNLPFELVSFPFADLALWVAVFFTVVSGWE YFSKNWEALKTSN
Source in vitro E.coli expression system
Gene Names pgsA
Protein Names Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5 Alternative name(s): Phosphatidylglycerophosphate synthase Short name= PGP synthase
Expression Region 1-193
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein catalyzes the committed step to the synthesis of the acidic phospholipids.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families CDP-alcohol phosphatidyltransferase class-I family
Database Links

KEGG: bsu:BSU16920

STRING: 224308.Bsubs1_010100009311

Related Products

pgsA Antibodies

pgsA Antibodies for Bacillus subtilis (strain 168)

pgsA Proteins

pgsA Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.