Recombinant Bacillus subtilis Hemolysin-3 homolog(yplQ)

Code CSB-CF346521BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P54175
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MFTIKEEIANAITHGIGVLLSIPALVFLIIFAANYGSAWDIVSFTIFGVSMLLLYLSSTL LHSITHKKTKDILEIIDHSAIYVLIAGTYTPFLLGPLKGTLGFTLLVIVWSLALGGIVFK IFFVKRFILLSTFVYLVMGWLMIIAVKPLYASLSGAGFSLLFLGGILYSVGTIFYIWKKI PFHHAIWHSFVLGGSAAMFFCVLFYCVKVPFLS
Source in vitro E.coli expression system
Gene Names yplQ
Protein Names Recommended name: Hemolysin-3 homolog Alternative name(s): Hemolysin III homolog
Expression Region 1-213
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0073 (Hly-III) family
Database Links

KEGG: bsu:BSU21790

STRING: 224308.Bsubs1_010100012001

Related Products

yplQ Proteins

yplQ Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.