Recombinant Bacillus subtilis Holin(xhlB)

Code CSB-CF859085BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99163
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MNTFDKGTVIRTVLLLIALINQTMLMLGKSPLDIQEEQVNQLADALYSAGSIAFTIGTTL AAWFKNNYVTEKGKKQRDLLRDNNLTK
Source in vitro E.coli expression system
Gene Names xhlB
Protein Names Recommended name: Holin
Expression Region 1-87
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in cell lysis upon induction of PbsX.
Subcellular Location Membrane, Single-pass membrane protein
Protein Families SPP1 holin family
Database Links

KEGG: bsu:BSU12800

STRING: 224308.Bsubs1_010100007096

Related Products

xhlB Antibodies

xhlB Antibodies for Bacillus subtilis (strain 168)

xhlB Proteins

xhlB Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.