Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ykoT(ykoT)

Code CSB-CF518525BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O34755
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MKQSQPVLTIVVPCFNEEEVFQETSHQLTEVVDDLIEEKLIAEDSKILFVDDGSKDRTWA LIAMESIRNKKVTGLKLACNVGHQKALLAGLHKAKNRSDCVISIDADLQDDISVIRDFML KYHEGCEIVYGVRRSRKTDTFFKRTTALGFYRLMNKLGIKLIYNHADFRLMNKRSLEELE RYPEANLFLRGIVPMIGFKSAEVLYDRKERFAGKTKYPLKKMLSFAFNGITSFSVAPIRF FTLLGFVLFFLSAVAGIGAFIQKLLGHTNAGWASLIISIWFLGGLQLMGIGIIGEYIGTI FSEVKRRPKYAIDIDLYNEQLSPLQRQEKERLEKKYS
Source in vitro E.coli expression system
Gene Names ykoT
Protein Names Recommended name: Uncharacterized glycosyltransferase ykoT EC= 2.4.-.-
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family
Database Links

KEGG: bsu:BSU13390

STRING: 224308.Bsubs1_010100007421

Related Products

ykoT Proteins

ykoT Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.