Recombinant Balaenoptera musculus ATP synthase protein 8(MT-ATP8)

Code CSB-CF015071BEC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P41292
Storage Buffer Tris-based buffer,50% glycerol
Species Balaenoptera musculus (Blue whale)
Sequence MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQTPWNITWTKIYLPLL
Source in vitro E.coli expression system
Gene Names MT-ATP8
Protein Names Recommended name: ATP synthase protein 8Alternative name(s): A6L F-ATPase subunit 8
Expression Region 1-63
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).
Subcellular Location Mitochondrion membrane, Single-pass membrane protein
Protein Families ATPase protein 8 family
Pathway Oxidative Phosphorylation

Related Products

MT-ATP8 Proteins

MT-ATP8 Proteins for Balaenoptera musculus (Blue whale)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.