Recombinant Bombyx mori Cecropin-D(CECD)

Code CSB-CF524922BTT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O76146
Relevance Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Bombyx mori (Silk moth)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ
Research Area Others
Source in vitro E.coli expression system
Gene Names CECD
Expression Region 25-60aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 7.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
Subcellular Location Secreted
Protein Families Cecropin family
Tissue Specificity Mainly in fat body. Lower in hemocytes. Not expressed in midguts, malpighian tubules and silk glands.
Database Links

KEGG: bmor:692369

STRING: 7091.BGIBMGA000017-TA

UniGene: Bmo.271

Related Products

CECD Proteins

CECD Proteins for BOMMO(Silk moth)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.