Recombinant Bombyx mori Octopamine receptor

Code CSB-CF624160BTT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q17232
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species BOMMO(Silk moth)
Sequence MGQAATHDANNYTSINYTEIYDVIEDEKDVCAVADEPNIPCSFGISLAVPEWEAICTAII LTMIIISTVVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQW VFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWI LSLVISSPPLLGWNDWPEVFEPDTPCRLTSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLA TKKRLRDRAKATKISTISSGRNKYETKESDPNDQDSVSSDANPNEHQGGTRLVAENEKKH RTRKLTPKKKPKRRYWSKDDKSHNKLIIPILSNENSVTDIGENLENRNTSSESNSKETHE DNMIEITEAAPVKIQKRPKQNQTNAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWL PFFVIYLVIPFCVSCCLSNKFINFITWLGYVNSALNPLIYTIFNMDFRRAFKKLLFIKC
Source in vitro E.coli expression system
Protein Names Recommended name: Octopamine receptor
Expression Region 1-479
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: bmor:693055

STRING: 7091.BGIBMGA011067-TA

UniGene: Bmo.9

Related Products

Proteins

Proteins for BOMMO(Silk moth)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.