Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF528365BTU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | O92500 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | BOMMOnuclear polyhedrosis virus (BmNPV) |
| Sequence | MSFFTNLRRVNKLYPNQASFLADNTRLLTSTPAGFTNVLNAPSVRNLGNNRYQPGYQLSN NRFVSTSDINRITRNNDVPNIRNVFQGISDPQINSLRQLRRMDNVPDFHYHTKQTRSNAV RQNFPETNVRTPEGVQNALQQNPRLHNHMRTLKVAGVGILLAGGGYLLFTASTLVQDIIN AINRTGGSYYVQGRNAGENVESCLLLQRTCRQDRNLAQSDVNICSRDPLLANDSPLLTNM CQGFNYETEKTVCRGSNPAANPNSPQYVDISDLPAGQTIMCIEPYSFSDLVGDLGLDWLL GREGLVGKSSNSSDGIRNKIMPIIMMIGAVLFLGLILYFIYRYMTKGGGGGGGSGGAPTP IVIMQHPASTTAPRR |
| Source | in vitro E.coli expression system |
| Gene Names | ODVP6E |
| Protein Names | Recommended name: Occlusion-derived virus envelope protein E56 Short name= ODV-E56 Alternative name(s): ODVP-6E |
| Expression Region | 1-375 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Structural protein that is specific for occlusion-derived virus (ODV) envelopes but not of budded virus (BV). |
| Subcellular Location | Virion membrane, Multi-pass membrane protein |
| Protein Families | Baculoviridae E56 family |
| Database Links |
KEGG: vg:1488756 |
ODVP6E Proteins for BOMMOnuclear polyhedrosis virus (BmNPV)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP528365BTU1 CSB-EP528365BTU1 CSB-BP528365BTU1 CSB-MP528365BTU1 |
Recombinant Bombyx mori nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56(ODVP6E),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Guanine nucleotide-binding protein G(o) subunit alpha(Gnao1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Nuclear transcription factor Y subunit beta(NFYB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related C3 botulinum toxin substrate 3(RAC3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Dog Matrix metalloproteinase-9(MMP9)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1(Hnrnpa2b1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Geobacillus stearothermophilus Gellan lyase,partial
Express system: E.coli
Species: Geobacillus stearothermophilus (Bacillus stearothermophilus)
