Recombinant Bovine ATP-binding cassette sub-family G member 2 (ABCG2)

Code CSB-CF673473BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ABCG2; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Urate exporter; CD antigen CD338
Species
Bos taurus (Bovine)
Expression Region
1-655
Target Protein Sequence
MSSNSYEVSIPMSKKLNGIPETTSKDLQTLTEGAVLSFHNICYRVKVKTGFLLCRKTIEK EILANINGVMKPGLNAILGPTGGGKSSLLDILAARKDPHGLSGDVLINGAPRPANFKCNS GYVVQDDVVMGTLTVRENLQFSAALRLPTTMTSYEKNERINKVIQELGLDKVADSKVGTQ FIRGVSGGERKRTSIAMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFGAIGFRCEPYNNPADFFLDIINGD SSAVVLNREDIGDEANETEEPSKKDTPLIEKLAEFYVNSSFFKETKVELDKFSGDQRRKK LPSYKEVTYATSFCHQLKWISRRSFKNLLGNPQASIAQLIVTVFLGLVIGAIFYDLKNDP AGIQNRAGVLFFLTTNQCFSSVSAVELLVVEKKLFIHEYISGYYRVSSYFFGKLLSDLLP MRMLPSIIFTCITYFLLGLKPKVEAFFIMMLTLMMVAYSASSMALAIAAGQSVVSIATLL MTISFVFMMIFSGLLVNLKTVVPWLSWLQYLSIPRYGYAALQHNEFLGQNFCPGLNVTTN NTCSYAICTGEEFLTNQGIDISPWGLWKNHVALACMIVIFLTIAYLKLLFLKKFS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells. Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme. Also mediates the efflux of sphingosine-1-P from cells. Acts as a urate exporter functioning in both renal and extrarenal urate excretion. In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. Mediates the secretion of the riboflavin and biotin vitamins into milk. Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. Plays an important role in the exclusion of xenobiotics from the brain. It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux. In placenta, it limits the penetration of drugs from the maternal plasma into the fetus. May play a role in early stem cell self-renewal by blocking differentiation.
Gene References into Functions
  1. ABCG2 single nucleotide polymorphisms associated with milk fatty acids in a Chinese Holstein cattle. PMID: 27468856
  2. These findings point to a significant role of the ABCG2 Y581S polymorphism in the milk disposition of enterolactone and the endogenous molecules riboflavin and uric acid, which could affect both milk quality and functionality. PMID: 26510964
  3. The results suggest that a mutation of SCD1, but not LEPR or ABCG2, might be useful as a DNA marker to decrease reproductive problems and improve production traits in Iranian Holstein dairy cows. PMID: 25130486
  4. P-gp, Bcrp and Mrp1 are functionally expressed in bovine/rat co-culture model and model is suitable for investigations of small molecule transport. PMID: 24934296
  5. This study has, for the first time, confirmed the expression of ABCG2 in epithelial cells of the bovine rumen. PMID: 24747985
  6. These results contribute to the role of ABCG2 in cytoprotection and disposition in important tissue barriers and may have important implications for veterinary pharmacotherapy of dairy animals. PMID: 23473424
  7. Generated cell culture model allows rapid and high-throughput screening of potential ruminant ABCG2 substrate, increasing the understanding of carrier-associated secretion of xenobiotics into milk. PMID: 23192864
  8. Bovine ABCG2 Tyr581Ser single-nucleotide polymorphism increases milk secretion of the veterinary antibiotic danofloxacin. PMID: 23230133
  9. ABCG2 plays a role in mammary epithelial cell proliferation, and functional polymorphisms in this gene may influence the cellular compartment of the mammary gland and potentially milk production. PMID: 22870877
  10. plays a role in epididymal sperm maturation, but not after ejaculation PMID: 22441796
  11. The effect of the Y581S polymorphism of ABCG2 on transcellular transport of veterinary drugs was studied because this could alter substrate pharmacokinetics and milk residues. PMID: 21821808
  12. Data suggest that the BB genotype of bovine ABCG2 is a molecular marker for superior milk performance. PMID: 20140710
  13. The recent progress in mapping quantitative trait nucleotides (QTNs) are reviewed, including the ABCG2 gene mutation that underlies a QTL for fat and protein content and the ovine MSTN gene mutation that causes muscular hypertrophy in Texel sheep. PMID: 20720303
  14. associated with increased fat yield, fat and protein percent as well as decrease in milk yield; also in Bos indicus and Bubalus bubalis PMID: 17087837
  15. The allele frequencies of ABCG2(A) and ABCG2(C) were determined in 32 Bos taurus and 3 Bos indicus breeds. The detection of ABCG2(C) only in Bos taurus breeds may indicate that ABCG2(A) is the ancestral allele. PMID: 17106124
  16. The C allele of ABCG2_49 is found in a marker haplotype that has an extremely negative effect on fat and protein percentages and positive effect on milk yield PMID: 17584938

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1