Recombinant Bovine Aquaporin-3(AQP3)

Code CSB-CF958823BO
Product Type Transmembrane Protein
Size $649
Uniprot No. Q08DE6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Bos taurus (Bovine)
Sequence MGRQKELVNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYTLAQTLGAFLGAGIIFGLYYDAIWAFANNQLIVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTAIAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEPPPPSTDEENVKLSHVKHKEQM
Source in vitro E.coli expression system
Gene Names AQP3
Expression Region 1-292
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: bta:780866

STRING: 9913.ENSBTAP00000011196

UniGene: Bt.53350

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.