Recombinant Bovine Cytochrome b5 (CYB5A)

Code CSB-CF006309BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CYB5A
Uniprot No.
Alternative Names
CYB5A; CYB5; Cytochrome b5
Species
Bos taurus (Bovine)
Expression Region
2-134
Target Protein Sequence
AEESSKAVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTFIIGELHPDDRSKITKPSESIITTIDSNPSWWTNWLIPAISAL FVALIYHLYTSEN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.
Gene References into Functions
  1. the conserved Tyr30 in Cyt b5 is not replaceable due to the presence of both the H-bond network and hydrophobic interaction in the secondary sphere of the heme active site. PMID: 27888781
  2. The study computes electron transfer rates for the [myoglobin(wt), cytochrome b5] complex. PMID: 22955681
  3. The solution structure of the oxidized cytochrome b(5) mutant V61H. PMID: 12893266
  4. the effects on the heme microenvironment of cytochrome b(5) caused by the mutation from Val45 to Tyr45, His45 and Glu45 PMID: 14644556
  5. Results from three combined experiments demonstrate that the conserved negatively charged region of cytb5 surrounding the solvent-exposed heme edge is involved in the binding interaction with horse heart cytochrome c. PMID: 14674751
  6. From a series of site-directed mutations on Cyt b5 this report assesses the contributions of amino acid residues that are expected to influence the docking and electron transfer (ET) between Cyt b5 and horse heart Cyt c. PMID: 15035623
  7. simulations provided qualitative microscopic explanations of many of the differences in physical properties between outer mitochondrial membrane CYB5 isoform and microsomal CYB5 and two mutants in terms of localized changes in structure and flexibility PMID: 16807901

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.
Protein Families
Cytochrome b5 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1