Recombinant Bovine Diacylglycerol O-acyltransferase 2-like protein 6(DGAT2L6)

Code CSB-CF006819BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6QP72
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MAFLSQLNLQEILQTLSVLQWMPVYVFLGAIPIIVIPYFLVFTKFWMVSVLALAWLAYDW NTHSQGGRRSAWVRNWTIWKYFQNYFPIKLVKTHDLSPRHNYIIASHPHGVLPYGTFINF ATETTGFARIFPGITPYVATLEGIFWIPIVREYVMSMGVCPVSELALKYLLTQKGSGNAV VIMVGGGAEALLCHPGATTVLLKQRKGFVKVALETGAYLVPSYSFGQNEVHNQETFPEGT WKRFFQKALQDTLKKLLRLSVCTFHGRGLTRGSWGFLPFNHPITTVVGEPLPIPRIKKPN EETVDKYHALYINALQKLFDEHKVQYGLSETQELTII
Source in vitro E.coli expression system
Gene Names DGAT2L6
Protein Names Recommended name: Diacylglycerol O-acyltransferase 2-like protein 6 EC= 2.3.1.-
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable acyltransferase uses fatty acyl-CoA as substrate. Has no wax synthase activity to produce wax esters.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Database Links

KEGG: bta:505958

STRING: 9913.ENSBTAP00000010259

UniGene: Bt.64325

Related Products

DGAT2L6 Proteins

DGAT2L6 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.