Recombinant Bovine Lutropin-choriogonadotropic hormone receptor (LHCGR)

Code CSB-CF635675BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
LHCGR
Uniprot No.
Alternative Names
LHCGR; Lutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R
Species
Bos taurus (Bovine)
Expression Region
27-701
Target Protein Sequence
LRPAPCPEPCSCPPDGALRCPGPQAGLSRLSLTYLPIKVIPSQAFRGLNEVIKIEISQSD SLEKIEANAFDNLLNLSEILIQNTKNLVHIEAGAFTNLPRLKYLSICNTGIHKLPDVTKI FSSEFNFILEICDNLHITTIPRNAFQGMNNESITLKLYGNGFEEIQSHAFNGTTLISLEL KENARLEKMHNDAFRGATGPSILDISSTKLQALPTYGLESIQTLIATSSYSLKKLPSREK FTNLLDATLTYPSHCCAFRNLPTNEQNFSFSIFKNFSKQCESTARRPNNETLYSAIFAES ELSGWDYDYGFCLPKTLQCAPEPDAFNPCEDIMGYNFLRVLIWLINILAITGNVTVLFVL LTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDAQTKGQYYNHAIDWQTGSGCSAAGF FTVFASELSVYTLTVITLERWHTITYAIQLDQKLRLKHAIPVMLGGWLFSTLIAVLPLVG VSNYMKVSICLPMDVESTLSQVYILTILILNVMAFIIICACYIKIYFAVQNPELMATNKD TKIAKKMAVLIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPVNSCANPFLYA IFTKAFQRDFFLLLSKFGCCKYRAELYRRKDFSAYISNCKNGFTGSNKPSRSTFKLTTLQ CQYSAVLDKTCYKEC
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene References into Functions
  1. large numbers of unknown LH-regulated granulosa cell genes are identified and their putative roles in ovarian function, are reported. PMID: 23716604
  2. Gene expression of granulosa cells reveals that 747 transcripts are potentially regulated by LH. PMID: 28840634
  3. The outcomes of the present study support a dynamic multi-facetted regulation of LHR during pre-translation. PMID: 26507944
  4. expression of LHR mRNA in bovine granulosa cells is established after follicle deviation, and the lower abundance of LRBP mRNA after the expected time of deviation may contribute to greater expression of LHR in the bovine dominant follicle PMID: 26446749
  5. These results suggested an acute regulation of INSL3 by luteinizing hormone (LH) because INSL3 concentrations increased immediately after endogenous and exogenous LH stimulation. PMID: 26318230
  6. INVESTIGATION OF STAT5A, FSHR AND LHR GENE POLYMORPHISMS IN TURKISH INDIGENOUS CATTLE BREEDS PMID: 26845856
  7. These findings strongly support the concept that IGF-1 upregulates LHR expression in granulosa cells and that IGF-1 is required for determining which follicle becomes dominant and acquires ovulatory capacity. PMID: 25626338
  8. LHCGR mRNA expression in granulosa cells was significantly higher in large antral follicles than in cysts, and not detected in granulosa cells of small and medium antral follicles. PMID: 25454493
  9. The luteinizing hormone receptor [LHR] splicing pattern is complex in bovine Leydig cells, and expression of full-length LHR and isoforms A and B changes when induced with LH. PMID: 22843048
  10. Significant correlations were found between sperm quality parameters and polymorphisms in the luteinizing hromoe receptor gene in Chinese Holstein bulls. PMID: 22327646
  11. The LHCGR gene is a potential marker for superovulation response and can be used to predict the most appropriate dose of FSH for superovulation in Chinese Holstein cows. PMID: 21667104
  12. Dominant follicles experience a reduction in FSH dependence (diminished expression of FSHR), but acquire increased LH dependence (enhanced expression of LHCGR) as they grow during the low FSH milieu of follicular waves. PMID: 16481595
  13. Three single nucleotide polymorphisms in LHCGR were significantly associated with variations in cattle fertility and production traits. PMID: 17121604
  14. Granulosa cells do not acquire functional LHR until follicle dominance occurs. PMID: 17154302
  15. Heterozygous heifers showed a higher pregnancy rate (67 and 66% for LHR and FSHR genes, respectively), but no significant effects were observed for the genes studied ( PMID: 18393228
  16. Differential expression of LHRH-receptor in bovine nasal tissue and its role in deslorelin delivery PMID: 18992782

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links

KEGG: bta:281900

STRING: 9913.ENSBTAP00000022047

UniGene: Bt.37

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1