Recombinant Bovine P2Y purinoceptor 14(P2RY14)

Code CSB-CF662242BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3SX17
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MNATSVPPAEGSCPSNALITKQIIPMLYFVVFVAGILLNGMSGWVFFYVPSSKSFIVYLK NIVIADFLMSLTFPFKILGDLGLGLWQVKVFVCRVSAVLFYINMYVSIVFFGLIGFDRYY KIVKPLLTSFIQSISYSKLLSVLVWSLTLLIALPNMILTNRNVTEATRVKCMDLKSDLGL KWHKASSYIFVGIFWIVFLSLIIFYTAITKKIFKSHFKSRKNSVSVKKKSSRNIFSIMFV FFICFVPYHIARIPYTQSQTEAHYSCQSKQILFYVKEFSLLLSAANVCLDPIIYFFLCQP FREVLCKKLHIQLKTQHDSETSKIKRENIIQESTDTL
Source in vitro E.coli expression system
Gene Names P2RY14
Protein Names Recommended name: P2Y purinoceptor 14 Short name= P2Y14 Alternative name(s): UDP-glucose receptor
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: bta:767936

STRING: 9913.ENSBTAP00000027950

UniGene: Bt.17368

Related Products

P2RY14 Proteins

P2RY14 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.