Recombinant Bovine Platelet-activating factor receptor(PTAFR)

Code CSB-CF018946BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9TTY5
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGILLSLIIWVSIVGAASYFFVLDSTNREPNKTGSANITRCFEHYEKG SIPVLTIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQIQRNAEVKRRALWMVCTVLAV FIICFVPHHLVQLPWTLAELGFQDTDFHQAINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVMQLKDVPVKSLKY
Source in vitro E.coli expression system
Gene Names PTAFR
Protein Names Recommended name: Platelet-activating factor receptor Short name= PAF-R Short name= PAFr
Expression Region 1-342
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system. May be involved in the morphological and physical modifications of the oviduct and uterus during the estrus cycle and early pregnancy (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Found in oviductal epithelial and stroma cells. Levels in the oviduct are raised at days 2-4 of both pregnancy and of the estrus cycle. In the endometrium, localization is predominantly to the apical borders of glandular and luminal epithelial cells. Expr
Database Links

KEGG: bta:518283

STRING: 9913.ENSBTAP00000038567

UniGene: Bt.63372

Pathway Calcium signaling pathway

Related Products

PTAFR Proteins

PTAFR Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.