Recombinant Bovine Transmembrane protein 85(TMEM85)

Code CSB-CF023887BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3T0K8
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MTAQGSLVANRGRRFKWAIELSGPGGGSRGRSDRGGGQGDSLYPVGYLDKQVPDTSVQET DRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATF KMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGG LLL
Source in vitro E.coli expression system
Gene Names EMC4
Protein Names Recommended name: Transmembrane protein 85
Expression Region 1-183
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May mediate anti-apoptotic activity.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families EMC4 family
Database Links

KEGG: bta:523162

STRING: 9913.ENSBTAP00000008411

UniGene: Bt.3625

Related Products

EMC4 Proteins

EMC4 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.