Recombinant Bovine V-type proton ATPase subunit e 2(ATP6V0E2)

Code CSB-CF642525BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2KIB5
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MTAHSFALPVVIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE
Source in vitro E.coli expression system
Gene Names ATP6V0E2
Protein Names Recommended name: V-type proton ATPase subunit e 2 Short name= V-ATPase subunit e 2 Alternative name(s): Vacuolar proton pump subunit e 2
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families V-ATPase e1/e2 subunit family
Database Links

KEGG: bta:505224

STRING: 9913.ENSBTAP00000007912

UniGene: Bt.21662

Pathway Oxidative Phosphorylation
Synaptic vesicle cycle

Related Products

ATP6V0E2 Proteins

ATP6V0E2 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.