Recombinant CDP-diacylglycerol--inositol 3-phosphatidyltransferase(pgsA)

Code CSB-CF884198MVW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9F7Y9
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium smegmatis
Sequence MSNVYLMTRAAYVKLSRPVAKAALRAGLTPDIVTLAGTAAAVIGALTLFPIGQLWWGAVV VSFFVLADMLDGAMAREQGGGTRFGAVLDATCDRLGDGAVFAGLTWWAAFGLDSPSLVVA TLICLVTSQVISYIKARAEASGLRGDGGIIERPERLVIVLIGAGLSDLPFFPLPWTLHVA MWVLAVASVVTLLQRVHAVRTSPGAMEPLHPANGEKPETSEP
Source in vitro E.coli expression system
Gene Names pgsA
Protein Names Recommended name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase EC= 2.7.8.11 Alternative name(s): Phosphatidylinositol synthase Short name= PI synthase
Expression Region 1-222
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families CDP-alcohol phosphatidyltransferase class-I family

Related Products

pgsA Proteins

pgsA Proteins for Mycobacterium smegmatis

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.