Recombinant Carassius auratus Vasoactive intestinal polypeptide receptor(vipr1)

Code CSB-CF856175DQG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q90308
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Carassius auratus (Goldfish)
Sequence MCDVVNEIELARARCENKTAGNVTSGCKGMWDIIACWPSAKVGEHVVIPCPNYFRHFSDH HEGNLSKTCTADGWTEMDPMEIAVYCGYNLNGTVDDDSFFRSVKIGYTIGHSVSLISLTT AIVILCMSRKLHCTRNYIHMHLFVSFILKAIAVFVKDAVLYDVIQESDNCSTASVGCKAV IVFFQYCIMASFFWLLVEGLYLHALLAVSFFSERKYFWWYILIGWGGPTIFIMAWSFAKA YFNDVGCWDIIENSDLFWWIIKTPILASILMNFILFICIIRILRQKINCPDIGRNESNQY SRLAKSTLLLIPLFGINFIIFAFIPENIKTELRLVFDLILGSFQGFVVAVLYCFLNGEVQ AEIKRKWRRWHLERFLGPDTKYQHPSMGSNGNNFSTQISMLTRCSPKTRRASTCQDETSI TVLGSTTMGYGHQNETVKGHEDVREVS
Source in vitro E.coli expression system
Gene Names vipr1
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor Short name= VIP receptor Short name= VIP-R
Expression Region 1-447
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family

Related Products

vipr1 Proteins

vipr1 Proteins for Carassius auratus (Goldfish)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.