Recombinant Caulobacter crescentus UPF0391 membrane protein CC_0673(CC_0673)

Code CSB-CF860534DQO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9AAC9
Storage Buffer Tris-based buffer,50% glycerol
Species Caulobacter crescentus (strain ATCC 19089 / CB15)
Sequence MLKWAIILAIVALIAGALGFSGLAGAAAGVAKILFFLFLVGFVLVLLLGGTVFKAATGPK
Source in vitro E.coli expression system
Gene Names CC_0673
Protein Names Recommended name: UPF0391 membrane protein CC_0673
Expression Region 1-60
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0391 family
Database Links

KEGG: ccr:CC_0673

STRING: 190650.CC_0673

Related Products

CC_0673 Proteins

CC_0673 Proteins for Caulobacter crescentus (strain ATCC 19089 / CB15)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.