Recombinant Chicken Hyaluronan synthase 2(HAS2)

Code CSB-CF010140CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O57424
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence MYCERFICILRILGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAILASHLIIQ SLFAYLEHRKMKRSLETPIKLNKTVALCIAAYQEDPDYLRKCLLSVKRLTYPGIKVVMVI DGNSEDDVYMMDIFTEIMGRDKSATYIWSNNFHDKGPGETEESHRESMQHVSQLVLSNKS VCIMQKWGGKREVMYTAFKALGEAWNYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGSQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK SSFASFLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSIWFTILLGRVIFTIYKESKKPFSESKTTVLVIGTILYACYWVLLLTLYLVLITKCGRR KKEQHYDMVLDV
Source in vitro E.coli expression system
Gene Names HAS2
Protein Names Recommended name: Hyaluronan synthase 2 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 2 Hyaluronic acid synthase 2 Short name= CHAS2 Short name= HA synthase 2
Expression Region 1-552
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Database Links

STRING: 9031.ENSGALP00000026394

UniGene: Gga.329

Related Products

HAS2 Proteins

HAS2 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.