Recombinant Cytochrome c1(petC)

Code CSB-CF006327RLX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P81379
Storage Buffer Tris-based buffer,50% glycerol
Species Blastochloris viridis (Rhodopseudomonas viridis)
Sequence QASGGDTPHLQSWSFAGPFGQYDKAQLRRGFQVFQNVCVSCHTLENGGFRNLPSRAAPNW PLDEVRQLAASWPVQVKDINDKGDPMQRAPKLPDRIPSQYANEAAARIIHNGAVPPDLSV IAKARTFQRGFPWWVTDIFTQYNENGVDYIVALLNGYEDPPERFKVPDGSFYNKYFPGHI IGMTPPIADGLVTYGDGTPETQLQYSKDVAAFLMWAAEPTLDVRKRIGWWVLGFLVIFTG LLVATKIVVWRPVKKGLA
Source in vitro E.coli expression system
Gene Names petC
Protein Names Recommended name: Cytochrome c1
Expression Region 25-282
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. c1 functions as an electron donor to cytochrome c.
Subcellular Location Cell membrane, Single-pass membrane protein

Related Products

petC Proteins

petC Proteins for Blastochloris viridis (Rhodopseudomonas viridis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.