Recombinant Danio rerio Alpha-2Db adrenergic receptor(adra2db)

Code CSB-CF812926DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8JG69
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MDLSTITFLLPNSSEDTNGTSAPRLPPHSQCASVLIVLVVTVIILVTIVGNVLVVVAVFT SRALRAPQNLFLVSLAAADILVATLVIPFSLANEVMGYWYLGSTWCAFYLALDVLFCTSS IVHLCAISLDRYWSVTKAVSYNLKRTPRRIKIMITVVWVISAVISFPPLLMTKHDELECL LNNETWYILSSCIVSFFAPGLIMILVYCRIYRVAKQRASTVFVAKNGMERQPSQSETCFV RKGKSEVESPSSHSSGSRERKGELDDIDLEESSVSNRHRNSRFAKSRKVEGAQSCPKPNG RLSWACSRASELEQEPRARQLSLSKSKLAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSL HAICRKSCTIPDSLFNLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKIMCRHSTRT
Source in vitro E.coli expression system
Gene Names adra2db
Protein Names Recommended name: Alpha-2Db adrenergic receptor Alternative name(s): Alpha-2Db adrenoceptor Short name= Alpha(2Db)AR Alpha-2Db adrenoreceptor
Expression Region 1-415
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The order of potency for this receptor is dexmedetomidine > norepinephrine = epinephrine > oxymetazoline.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2D sub-subfamily
Database Links

KEGG: dre:266755

STRING: 7955.ENSDARP00000071372

UniGene: Dr.89694

Related Products

adra2db Antibodies

adra2db Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

adra2db Proteins

adra2db Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.