Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 2(ergic2)

Code CSB-CF766474DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7T2D4
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MRRLNKKKALNFVRELDAFPKVPESYVETTASGGTVSLLAFTAMALLAFFEFFVYRDTWM KYEYEVDKDFTSKLRINIDITVAMRCQFVGADVLDLAETMVASDGLVYEPVVFDLSPQQR LWHRTLLLIQGRLREEHSLQDVLFKNVMKGSPTALPPREDDPNQPLNACRIHGHLYVNKV AGNFHITVGKAIPHPRGHAHLAALVSHETYNFSHRIDHLSFGEEIPGILNPLDGTEKVSA DHNQMFQYFITIVPTKLQTYKVYADTHQYSVTERERVINHAAGSHGVSGIFMKYDISSLM VKVTEQHMPFWQFLVRLCGIIGGIFSTTGMLHNLVGFCVDVVCCRFKLGVYKPKSMSDFD GQINSLTPLLSENAEQ
Source in vitro E.coli expression system
Gene Names ergic2
Protein Names Recommended name: Endoplasmic reticulum-Golgi intermediate compartment protein 2
Expression Region 1-376
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possible role in transport between endoplasmic reticulum and Golgi.
Subcellular Location Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERGIC family
Database Links

KEGG: dre:393378

STRING: 7955.ENSDARP00000068141

UniGene: Dr.12056

Related Products

ergic2 Antibodies

ergic2 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

ergic2 Proteins

ergic2 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.