Recombinant Danio rerio Erlin-2(erlin2)

Code CSB-CF007791DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A3QK16
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MTLGAVASLILAIGGAAVFSALHKIEEGHVGVYYRGGALLTATSGPGFHLMLPFITTFKSVQTTLQTDEVKNVPCGTGGGVMIYFDRIEVVNYLVPSAVYGIVRNFTADYDKALIFNKVHHELNQFCSVHTLQDVYIGLFDQIDENLKLTLQEDLTSMAPGLIIQAVRVTKPNIPESIRRNYELMESERTKLLIAAQTQKVVEKEAETERKKAVIEAEKVAQVAEIKFGQKVMEKETEKKISQIEDSAYLARQKAKADAEFYSAQRAAEANKLKLTPEYLQLMKFKAIAANSKIYFGSEIPHMFMDSGPGSSSSAASKAIDVLSEGMLDLE
Source in vitro E.coli expression system
Gene Names erlin2
Protein Names Recommended name: Erlin-2 Alternative name(s): Endoplasmic reticulum lipid raft-associated protein 2
Expression Region 1-331
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs). Promotes sterol-accelerated ERAD of HMGCR. Involved in regulation of cellular cholesterol homeostasis by regulation the SREBP signaling pathway (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Band 7/mec-2 family
Database Links

KEGG: dre:100151163

STRING: 7955.ENSDARP00000121177

UniGene: Dr.26703

Related Products

erlin2 Antibodies

erlin2 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

erlin2 Proteins

erlin2 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.